PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA029388-PA
Common NameOsI_32143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 315aa    MW: 32021.5 Da    PI: 8.754
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA029388-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702228.21.5e-70922423153
            DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae 95 
                        g++sCqdCGnqakkdC+h+RCRtCCksrgf CathvkstWvpaakrrerqqqlaa++++aaa+a  a + r+ +++ +++ ++++ ++ss++
  BGIOSGA029388-PA  92 GGGISCQDCGNQAKKDCTHMRCRTCCKSRGFACATHVKSTWVPAAKRRERQQQLAALAASAAATAGGAGPSRDPTKRPRARPSATTPTTSSGD 184
                       5789********************************************************99999877777777778889999999999**** PP

            DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                       +++ + ++++P+evsseavfrcvr++ vd++e+e+aYqtavsigGhvfkGiL+d G+e
  BGIOSGA029388-PA 185 QQMVTVAERFPREVSSEAVFRCVRLGPVDQAEAEVAYQTAVSIGGHVFKGILHDVGPE 242
                       ********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.8E-6694242IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.4E-2796138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.1E-22193241IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAGFPLGGGS HSRDNPAPPV PPVHPADAAS FLYATRGGSF QLWQQQEQQP FYASNIIRFA  60
DDAPPAPSLA GASSSSSSRG MRSSGGGGGG GGGGISCQDC GNQAKKDCTH MRCRTCCKSR  120
GFACATHVKS TWVPAAKRRE RQQQLAALAA SAAATAGGAG PSRDPTKRPR ARPSATTPTT  180
SSGDQQMVTV AERFPREVSS EAVFRCVRLG PVDQAEAEVA YQTAVSIGGH VFKGILHDVG  240
PEALAVAGGG GASEYHFRLT GDGSSPSTAA AGEAGSGGGG NIIVSSAVVM DPYPTPGPYG  300
AFPAGTPFFH GHPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.89640.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976098430.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412850.0AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611315.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA0A0E0IMR70.0A0A0E0IMR7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QU830.0A0A0E0QU83_ORYRU; Uncharacterized protein
TrEMBLA2Z3E00.0A2Z3E0_ORYSI; Putative uncharacterized protein
TrEMBLQ652K40.0Q652K4_ORYSJ; Os09g0531600 protein
STRINGBGIOSGA029388-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os09g36160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.19e-41Lateral root primordium (LRP) protein-related